PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00433.80
Common NameJCGZ_21170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family TALE
Protein Properties Length: 378aa    MW: 42288.7 Da    PI: 6.4536
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00433.80genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-093063402155
                    HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
       Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                    k +yps++++  LA+++gL+++q+ +WF N+R ++
  Jcr4S00433.80 306 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 340
                    569*****************************885 PP

2ELK36.78.9e-13260281122
            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                    ELK qLlr Ysg+Lg+LkqEF+
  Jcr4S00433.80 260 ELKGQLLRRYSGCLGNLKQEFM 281
                    9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.9E-20108152IPR005540KNOX1
PfamPF037902.2E-22110148IPR005540KNOX1
SMARTSM012569.1E-26157208IPR005541KNOX2
PfamPF037918.1E-21161207IPR005541KNOX2
SMARTSM011881.7E-7260281IPR005539ELK domain
PROSITE profilePS5121310.319260280IPR005539ELK domain
PfamPF037892.9E-10260281IPR005539ELK domain
PROSITE profilePS5007112.989280343IPR001356Homeobox domain
SMARTSM003897.4E-13282347IPR001356Homeobox domain
SuperFamilySSF466891.92E-19282356IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-28285345IPR009057Homeodomain-like
CDDcd000861.86E-12292344No hitNo description
PfamPF059206.9E-17300339IPR008422Homeobox KN domain
PROSITE patternPS000270318341IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MEGGSNSTSC MMAFGDNSNG LCPMMMMPLM TSHPHHHHHH PPPPPPNADS SSNTLFLPLP  60
PPTNHQDQNR NSSSASSMIL DDHNNTTTTT TNTNTSCYFM DSNDGSAASV KAKIMAHPHY  120
HRLLAAYINC QKVGAPPEVV ARLEEACASA AAMGPTGTSC VGEDPALDQF MEAYCEMLTK  180
YEQELSKPFK EAMLFLQRVE CQFKALTVSS PNSGDNNLSL SHCLMRVLVA CGEAGERNGS  240
SEEEVDVNNN FIDPQAEDQE LKGQLLRRYS GCLGNLKQEF MKKRKKGKLP KEARQQLLDW  300
WSRHYKWPYP SESQKLALAE STGLDQKQIN NWFINQRKRH WKPSEDMQFV VMDATHPHYY  360
VDNVLGNPFP MDISPTLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275284LKQEFMKKRK
2281285KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1449091e-124EF144909.1 Populus trichocarpa clone WS01119_M04 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091289.10.0PREDICTED: homeobox protein SBH1
SwissprotP466081e-159HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A067JMJ40.0A0A067JMJ4_JATCU; Uncharacterized protein
STRINGVIT_10s0116g00190.t011e-180(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-135KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]